SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 176299.Atu0082 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  176299.Atu0082
Domain Number 1 Region: 2-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.42e-52
Family Ribonuclease PH domain 1-like 0.000018
Further Details:      
 
Domain Number 2 Region: 297-469
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.07e-49
Family Ribonuclease PH domain 1-like 0.0000147
Further Details:      
 
Domain Number 3 Region: 145-235
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.52e-30
Family Ribonuclease PH domain 2-like 0.00095
Further Details:      
 
Domain Number 4 Region: 451-546
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.24e-27
Family Ribonuclease PH domain 2-like 0.00015
Further Details:      
 
Domain Number 5 Region: 556-641
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.55e-22
Family Eukaryotic type KH-domain (KH-domain type I) 0.0023
Further Details:      
 
Domain Number 6 Region: 621-703
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.93e-20
Family Cold shock DNA-binding domain-like 0.00057
Further Details:      
 
Domain Number 7 Region: 240-322
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 1.31e-17
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 176299.Atu0082
Sequence length 713
Comment (Agrobacterium tumefaciens C58 Cereon)
Sequence
MFNKHSVEIEWAGRPLKLETGKVARQADGAVIATYGETMVLATVVSAKSPKPGQDFFPLT
VNYQEKTYAAGKIPGGYFKREGRPSEKETLVSRLIDRPIRPLFPEGYKNDTQVVVTVIQH
DLENDPDVLSMVAASAALTLSGIPFMGPVGGARVGYINGEYVLNPHLDEMDESVLDLVVA
GTQDAVLMVESEAKELNEEIMLGAVMFGHKGFQPVIDAIIKLAEVAAKEPREFEPEDFSA
LENEMLGLAETELRTAYKITEKAARYAAVDAVKTKVKAHFLPEEGEAKYSPEEIGAVFKH
LQAKIVRWNVLDTKSRIDGRDLSTVRPIVSEVGILPRTHGSALFTRGETQAIVVATLGTG
EDEQYVDSLTGMYKERFLLHYNFPPYSVGETGRMGSPGRREIGHGKLAWRAIRPMLPTAE
QFPYTLRVVSEITESNGSSSMATVCGTSLALMDAGVPLAKPVAGIAMGLILEGERFAVLS
DILGDEDHLGDMDFKVAGTADGITSLQMDIKIAGITEEIMKIALEQAQGGRKHILGEMAN
AITESRGQLGEFAPRIEVMNIPVDKIREVIGSGGKVIREIVEKTGAKINIEDDGTVKIAS
ASGKEIEAARKWIHSIVAEPEVGQIYEGTVVKTADFGAFVNFFGARDGLVHISQLASERV
AKTSDVVKEGDKVWVKLMGFDERGKVRLSMKVVDQATGKEVAADKKDGEAAAE
Download sequence
Identical sequences A0A083ZN80 A9CKQ7
gi|15887437|ref|NP_353118.1| NP_353118.1.86381 WP_010970644.1.51814 WP_010970644.1.57042 AtR202 176299.Atu0082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]