SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 176299.Atu4041 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  176299.Atu4041
Domain Number 1 Region: 12-219
Classification Level Classification E-value
Superfamily Pseudouridine synthase 4.64e-60
Family Pseudouridine synthase RsuA/RluD 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 176299.Atu4041
Sequence length 222
Comment (Agrobacterium tumefaciens C58 Cereon)
Sequence
MSLKLSNPIYNPPLDPWLTIVHRDDDLLVLDKPSGLLSVPGRDPALSDSLMTRVQKQFPK
ALMINRLDKDTSGIVLMSLNRKAHAAIAAQFEKRETRKSYVAIVWGTVAGEEGEVDLPLA
IDPDNKPRHRVDHENGKPAQSLWRVLERLPLPATRLALTPLTGRTHQLRVHMKALGHPIL
GDEFYAEGEALTAAPRLMLHAQEVGFRHPDGRDVTYTVPCPF
Download sequence
Identical sequences A0A083ZTD1 A0A1G9AH55 A9CFZ5
176299.Atu4041 gi|15890930|ref|NP_356602.1| NP_356602.1.86381 WP_010973520.1.11033 WP_010973520.1.51814 WP_010973520.1.57042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]