SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 177416.FTT_1644 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  177416.FTT_1644
Domain Number 1 Region: 25-332
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 1.73e-90
Family Glycosyl hydrolases family 32 N-terminal domain 0.00000728
Further Details:      
 
Domain Number 2 Region: 332-473
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.37e-18
Family Glycosyl hydrolases family 32 C-terminal domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 177416.FTT_1644
Sequence length 474
Comment (Francisella tularensis tularensis)
Sequence
MCFSLRADSFKSYHSHDNSDIHKTKRLQYHFTAKKAWMNDPNGLVYFKGKYHMFYQHYPY
GKHTAMLHWGHAVSTDLVNWQHLPIAIYPQNDLNDRYIGGAFSGSAMVVDDELFLIYTEH
FEDLDNTPNIFIEKQNLIKSKDGIHFSKPKTVINHKPDFCSYDFRDPKVWFDKIFNCYYM
VIGTYANNYPSVALYRSDNAESWNYHSILFQEKTISGRTLECLDLFYLDGKYVLVLSIFE
TKNKKDFNYQSYYYIGNFDGKHFSAETPPKHIDSAKEFYAPQTFEANGNRYAIGWMNCWE
DYKNRAKDDSAGAMSLIRQLKVKKDKLLSYPVDDYKNLRNKTIEIKNFDQDITLPSNLIE
LNLDFSSDNNWQLDLLENNQGFVINIHYQDNQILVKNSLNEVIDKAFIKDIRSQEISVDI
FLDTTSIELFVNKGEESITMRFEASDTIKNTMRVSAVNQDDLTIKLYELNSVWK
Download sequence
Identical sequences A0A2J9SQ22 Q5NEI9
gi|56708657|ref|YP_170553.1| gi|110671129|ref|YP_667686.1| WP_011242290.1.101979 WP_011242290.1.10388 WP_011242290.1.11695 WP_011242290.1.1833 WP_011242290.1.2301 WP_011242290.1.25812 WP_011242290.1.31410 WP_011242290.1.35965 WP_011242290.1.3831 WP_011242290.1.38368 WP_011242290.1.38474 WP_011242290.1.38662 WP_011242290.1.44744 WP_011242290.1.52816 WP_011242290.1.56738 WP_011242290.1.5829 WP_011242290.1.59625 WP_011242290.1.60146 WP_011242290.1.61154 WP_011242290.1.65967 WP_011242290.1.66092 WP_011242290.1.67317 WP_011242290.1.75261 WP_011242290.1.80616 WP_011242290.1.82545 WP_011242290.1.87851 WP_011242290.1.98147 YP_170553.1.84429 177416.FTT_1644 393115.FTF1644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]