SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 177437.HRM2_34180 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  177437.HRM2_34180
Domain Number 1 Region: 15-82
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.0000000000000921
Family Ferredoxin domains from multidomain proteins 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 177437.HRM2_34180
Sequence length 96
Comment (Desulfobacterium autotrophicum HRM2)
Sequence
MKHSPKHCKQRRVSFIDRGRQMTIENIDNDKCIGCGTCVATCPADVIRLDKIIKRAKITY
PEDCQNCHLCRLFCPVSNDVITISARTCLEPMISWG
Download sequence
Identical sequences C0QMH6
gi|224370493|ref|YP_002604657.1| 177437.HRM2_34180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]