SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 177439.DP2509 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  177439.DP2509
Domain Number 1 Region: 39-165
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 0.0000000000091
Family Multidomain sulfurtransferase (rhodanese) 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 177439.DP2509
Sequence length 175
Comment (Desulfotalea psychrophila LSv54)
Sequence
MLSAIPIGTGRNYGVECSSCISISCLWKIVKRRVFRMKRIIAIVFCLLCVASTSFAGNYN
YISAKQVKENLAVGSAMIIVDIQVEKEFNRHHLPGSVATYAYPVKSDVERARIDQAVKLY
EQSGSPVVVVCPGGKSGAKRCYDYMESKNVPAEKMMILENGMGGWPYKELVQTKN
Download sequence
Identical sequences Q6AK88
gi|51246361|ref|YP_066245.1| 177439.DP2509 WP_011189750.1.98904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]