SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 177439.DP2728 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  177439.DP2728
Domain Number 1 Region: 118-369
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.81e-68
Family RecA protein-like (ATPase-domain) 0.0000000254
Further Details:      
 
Domain Number 2 Region: 50-125
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.03e-29
Family Cold shock DNA-binding domain-like 0.0000494
Further Details:      
 
Domain Number 3 Region: 1-46
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.00000000000589
Family Rho termination factor, N-terminal domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 177439.DP2728
Sequence length 416
Comment (Desulfotalea psychrophila LSv54)
Sequence
MNLAELKLKKIGDLVQLARQLNVEGYSILRKQELIFAILQAQADKEGKMRGSGVLEILPD
GFGFLRAPDYNYLPGPDDIYVSPSQIRRLNLRTGDTIDGMVRAPKEGERYFALLKVESVN
FDSPEAAKQKTLFGNLTPLHPDEAFDLDCDSDNYSIRAMDLFAPIGKGQRGLLVAPPRTG
KTVFMQKLANTIVRNHPEVYLIVLLIDERPEEVTEMSRSVKAAEVVSSTFDEPPQRHIQV
AEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVTPASGKILSGGVEANALHRPKRFFG
AARNIEEGGSLTIIATALIETGSRMDEVIFEEFKGTGNMELVLDRKMADKRIFPAIDIRR
SGTRKEELLMKPDKLNRIWILRKILNAMNPSDCMDFLMDKLKHHKTNAEFIDNMNG
Download sequence
Identical sequences Q6AJM3
WP_011189969.1.98904 177439.DP2728 gi|51246580|ref|YP_066464.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]