SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 178306.PAE1358 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  178306.PAE1358
Domain Number 1 Region: 52-203
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.88e-35
Family Glutathione peroxidase-like 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 178306.PAE1358
Sequence length 207
Comment (Pyrobaculum aerophilum)
Sequence
MPRKYILLFLAILIPFVVAVIMQSQLGATAEEHSGLFERVVPVCYLPGREPPAADFELIN
QYGERVRLSDYWSRPVLITFTYTYCPDVCPLMNLVLNKTLPLVPNLFGAVFDVSLDPDRD
TPERLLAYSRGNRYNWTFLTGDYATLEKVWRAYGVTRYVENRNGVPYIAHDVLYIVVQNG
KILGLVRGLPAPETLADYLKKIVSRQC
Download sequence
Identical sequences Q8ZXC0
178306.PAE1358 gi|18312580|ref|NP_559247.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]