SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 178306.PAE2013 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  178306.PAE2013
Domain Number 1 Region: 4-74
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.00000000238
Family Single 4Fe-4S cluster ferredoxin 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 178306.PAE2013
Sequence length 75
Comment (Pyrobaculum aerophilum)
Sequence
MPVKVKIDRSKCVVAHFCLFYAPTVFIPGDGGKPVISPEYASGGMEEGYVPEELYDQVKE
AERHCPSRAIKVYRE
Download sequence
Identical sequences Q8ZW20
178306.PAE2013 gi|18313034|ref|NP_559701.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]