SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 178306.PAE2208 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  178306.PAE2208
Domain Number 1 Region: 57-150
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.62e-18
Family Cold shock DNA-binding domain-like 0.0014
Further Details:      
 
Domain Number 2 Region: 146-227
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.18e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.00043
Further Details:      
 
Domain Number 3 Region: 1-56
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 0.00000000000497
Family ECR1 N-terminal domain-like 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 178306.PAE2208
Sequence length 235
Comment (Pyrobaculum aerophilum)
Sequence
MYYVTPRQLVFPGDVIATADSKVEGPVYLDNGKYRSLVVGLVEFREDVVVVVPLEGTYKP
KKGDLVIGYVTDVLATGWEVDVRSFMPAYLPVGEALHRHVDLETTPLTTFLNIGDVVVAK
VKDVDLTDEYPIILTLKDEKVGKVESGTVVEITPVKVPRVIGKRGSMLNTLMELGCDIVV
GQNGRIWVKCKDPRDEVFLASLIRKIEAESHVMGLTDRIRAEIENYKTSKQQGTV
Download sequence
Identical sequences Q8ZVM8
gi|18313179|ref|NP_559846.1| 178306.PAE2208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]