SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 178306.PAE3473 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  178306.PAE3473
Domain Number 1 Region: 89-170
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000234
Family Eukaryotic type KH-domain (KH-domain type I) 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 178306.PAE3473
Sequence length 175
Comment (Pyrobaculum aerophilum)
Sequence
MASEYLRGIIYEPIDKKRLRAAREFVKLVDGKYGHRVELDEKQLYIKITPGPEATVDSIL
KIRDMARAIALGFDPEKALMLENDEYTLAVIELKEYTDKPNHLRRIKGRIIGEEGRAKRT
IENLAEVSMVVGDNYVALLGKLDDVEIAKRAVEMIIEGKKHGTVYKFIQSVKRRR
Download sequence
Identical sequences Q8ZT20
178306.PAE3473 gi|18314094|ref|NP_560761.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]