SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 182082.CpB1037 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  182082.CpB1037
Domain Number 1 Region: 297-488
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.58e-45
Family Ribonuclease PH domain 1-like 0.0000351
Further Details:      
 
Domain Number 2 Region: 12-143
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.37e-39
Family Ribonuclease PH domain 1-like 0.0000915
Further Details:      
 
Domain Number 3 Region: 453-560
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.57e-26
Family Ribonuclease PH domain 2-like 0.0002
Further Details:      
 
Domain Number 4 Region: 137-229
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.09e-24
Family Ribonuclease PH domain 2-like 0.0014
Further Details:      
 
Domain Number 5 Region: 610-692
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.82e-19
Family Cold shock DNA-binding domain-like 0.00064
Further Details:      
 
Domain Number 6 Region: 548-622
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.96e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0041
Further Details:      
 
Domain Number 7 Region: 227-326
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.00000000000000262
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 182082.CpB1037
Sequence length 694
Comment (Chlamydophila pneumoniae TW 183)
Sequence
MNFQTISINLTEGKILVFETGKIARQANGAVLVRSGETCVFASACAVDLDDKVDFLPLRV
DYQEKFSSTGKTLGGFIKREGRPSEKEILVSRLIDRSLRPSFPYRLMQDVQVLSYVWSYD
GQVLPDPLAICAASAALAISDIPQSNIVAGVRIGCIDNQWVINPTKTELASSTLDLVLAG
TENAILMIEGHCDFFTEEQVLDAIEFGHKHIVTICKRLQLWQEEIGKSKNLSAVYPLPAE
VLTAVKECAQDKFTELFNIKDKKVHAATAHEIEENILEKLQREDDDLFSSFNIKAACKTL
KSDTMRALIRDREIRADGRSLTTVRPITIETSYLPRTHGSCLFTRGETQTLAVCTLGSEA
MAQRYEDLNGEGLSKFYLQYFFPPFSVGEVGRIGSPGRREIGHGKLAEKALSHALPDSAT
FPYTIRIESNITESNGSSSMASVCGGCLALMDAGVPISSPIAGIAMGLILDDQGAIILSD
ISGLEDHLGDMDFKIAGSGKGITAFQMDIKVEGITPAIMKKALSQAKQGCNDILNIMNEA
LSAPKADLSQYAPRIETMQIKPTKIASVIGPGGKQIRQIIEETGVQIDVNDLGVVSISAS
SASAINKAKEIIEGLVGEVEVGKTYRGRVTSVVAFGAFVEVLPGKEGLCHISECSRQRIE
NISDVVKEGDIIDVKLLSINEKGQLKLSHKATLE
Download sequence
Identical sequences A0A0F7XUR7
WP_011126275.1.81029 gi|33242368|ref|NP_877309.1| 182082.CpB1037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]