SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 183190.PD0122 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  183190.PD0122
Domain Number 1 Region: 2-202
Classification Level Classification E-value
Superfamily PRTase-like 1.29e-43
Family Phosphoribosyltransferases (PRTases) 0.00000506
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 183190.PD0122
Sequence length 219
Comment (Xylella fastidiosa Temecula1)
Sequence
MSHYRQRFLQLALDSNALCFGEFTLKSGRISPYFFNAGHFNSGAKTAALAQCYADAIDAA
NMNFDLVFGPAYKGIPLATALACEYAQRERDLLLTFNRKEVKNHGEGGTLIGAPLNGRKI
LIIDDVITAGTAIREVLRIIRNAGGTPTGVAVALNRQEIASETNRQSSVQALMAETGIPV
VAIATLNDLLAFVEENASLAKFYEPLLAYKTHYGTEAPD
Download sequence
Identical sequences A0A1M5L239 Q87F16
gi|28198058|ref|NP_778372.1| gi|386084202|ref|YP_006000484.1| WP_004087761.1.14680 WP_004087761.1.15411 WP_004087761.1.44032 WP_004087761.1.56643 WP_004087761.1.69964 WP_004087761.1.88863 WP_004087761.1.90029 183190.PD0122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]