SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 186103.spyM18_2014 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  186103.spyM18_2014
Domain Number 1 Region: 7-142
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.09e-44
Family Ribonuclease PH domain 1-like 0.0000396
Further Details:      
 
Domain Number 2 Region: 297-490
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.77e-41
Family Ribonuclease PH domain 1-like 0.0000108
Further Details:      
 
Domain Number 3 Region: 143-233
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.14e-29
Family Ribonuclease PH domain 2-like 0.002
Further Details:      
 
Domain Number 4 Region: 453-551
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.96e-28
Family Ribonuclease PH domain 2-like 0.0000942
Further Details:      
 
Domain Number 5 Region: 623-706
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.14e-20
Family Cold shock DNA-binding domain-like 0.00099
Further Details:      
 
Domain Number 6 Region: 559-643
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.32e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0025
Further Details:      
 
Domain Number 7 Region: 236-323
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.000000000000628
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 186103.spyM18_2014
Sequence length 710
Comment (Streptococcus pyogenes MGAS8232)
Sequence
MSKQTFTTTFAGKPLVVEVGQVAKQANGATVVRYGESTVLTAAVMSKKMATGDFFPLQVN
YEEKMYAAGKFPGGFMKREGRPSTDATLTARLIDRPIRPMFAEGFRNEVQVINTVLSYDE
NASAPMAAMFGSSLALSISDIPFNGPIAGVQVGYIDGEFIINPDKEQMEASLLELTVAGS
KEAINMVESGAKELSEDIMLEALLKGHQAIQELIAFQEQIVAVVGKEKAEVELLQVDADL
QADIVAKYNAQLQKAVQVEEKKAREAATEAVKEMVKAEYEERYAEDENLATIMRDVAEIL
EQMEHAEVRRLITEDKIRPDGRKIDEIRPLDAVVDFLPKVHGSGLFTRGQTQALSVLTLA
PMGETQIIDGLAPEYKKSFLHHYNFPQYSVGETGRYGAAGRREIGHGALGERALEQVLPS
LEEFPYAIRLVAEVLESNGSSSQASICAGTLALMAGGVPIKAPVAGIAMGLISDGTNYTV
LTDIQGLEDHFGDMDFKVAGTREGITALQMDIKIAGITPQILEEALAQAKKARFEILDVI
EATIAEPRPELAPTAPKIDTIKIDVDKIKVVIGKGGETIDKIIAETGVKIDIDDEGNVSI
YSSDQAAIDRTKEIIAGLVREAKVGEVYHAKVIRIEKFGAFVNLFDKTDALVHISEIAWT
RTTNVSDVLEVGEDVDVKVIKIDEKGRVDASMKALIPRPPKPEKKEEKHD
Download sequence
Identical sequences Q8NZC6
186103.spyM18_2014 gi|19746859|ref|NP_607995.1| WP_011018235.1.10776 WP_011018235.1.19471 WP_011018235.1.25570 WP_011018235.1.30208 WP_011018235.1.45787 WP_011018235.1.51111 WP_011018235.1.56335 WP_011018235.1.64024 WP_011018235.1.65729 WP_011018235.1.69961 WP_011018235.1.87596 WP_011018235.1.9206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]