SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 186497.PF1034 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  186497.PF1034
Domain Number 1 Region: 4-168
Classification Level Classification E-value
Superfamily PRTase-like 3.28e-51
Family Phosphoribosyltransferases (PRTases) 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 186497.PF1034
Sequence length 182
Comment (Pyrococcus furiosus)
Sequence
MKEELIRMILEEECIKFGHFILTSGKESSYYIDIKKLITNPKALRLIARLIKEKAEEEGI
QFDKVAGPELGAVPIATALALETDRPLLIVRKKKKEHGTGRQIEGEVKEGDRVLLVEDVT
TTGGSVLRAAKILKEAGAEITGIFVVVDREEGAKEAIEKEGFKLYPLVLVHELFEAAGVS
SE
Download sequence
Identical sequences I6UYU1 P58861
Pfu-990043-001 186497.PF1034 gi|397651541|ref|YP_006492122.1| gi|18977406|ref|NP_578763.1| WP_011012171.1.13913 WP_011012171.1.59273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]