SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 186497.PF1580 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  186497.PF1580
Domain Number 1 Region: 122-203
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.36e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.00048
Further Details:      
 
Domain Number 2 Region: 32-112
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000259
Family Eukaryotic type KH-domain (KH-domain type I) 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 186497.PF1580
Sequence length 221
Comment (Pyrococcus furiosus)
Sequence
MGEDFEKLMKKFEKVSKDGEIIKEEEDEEWEEFFKQEEYVKIPKERIGVLIGKKGQTKRE
IEKRTKTKIEVDSETGEVWITSTKETTDPLAVWKARDIVLAIGRGFSPERAFRLLNEGEY
LEIINLTDIIIGNEKNALPRVRGRIIGRKGRTREIIEEMSGASISVYGKTVAIIGNPIQI
EIARTAIEKLARGSPHGTVYRYLERRKKDLELEGSMYYENL
Download sequence
Identical sequences I6U8F2 Q8U0K7
gi|397652073|ref|YP_006492654.1| Pfu-1476753-001 186497.PF1580 WP_011012726.1.13913 WP_011012726.1.59273 gi|18977952|ref|NP_579309.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]