SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 187410.y3315 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  187410.y3315
Domain Number - Region: 28-100
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0688
Family Leukotriene A4 hydrolase catalytic domain 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 187410.y3315
Sequence length 187
Comment (Yersinia pestis KIM 10)
Sequence
MVMSACIWLSTVLFFRIMSTLRIPIALQQAVMQCLRHYLQLANQHLGTAYPEPKVNYHQR
GTNAGSAYLQSFEIRLNPVLLLENKQPFIDEVVPHELAHLLVYRQFGRVAPHGKEWRWMM
EQVLKVPASRTHQFEVASVRSKTFNYQCKCQQHALTIRRHNKVLRGESEYRCRQCGEKLQ
FITINPD
Download sequence
Identical sequences gi|384121344|ref|YP_005503964.1| gi|45443249|ref|NP_994788.1| gi|384125216|ref|YP_005507830.1| 187410.y3315 229193.YP_3511 349746.YpAngola_A3346 gi|162420273|ref|YP_001607689.1| gi|22127191|ref|NP_670614.1| gi|294502905|ref|YP_003566967.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]