SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 187420.MTH129 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  187420.MTH129
Domain Number 1 Region: 8-226
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.01e-58
Family Decarboxylase 0.00000000618
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 187420.MTH129
Sequence length 228
Comment (Methanobacterium thermoautotrophicum)
Sequence
MRSRRVDVMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFR
KRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFRGADSVRACLNVAEEMGREV
FLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISP
GVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDLLNP
Download sequence
Identical sequences O26232
gi|15678157|ref|NP_275272.1| APC052 187420.MTH129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]