SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 187420.MTH250 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  187420.MTH250
Domain Number 1 Region: 77-168
Classification Level Classification E-value
Superfamily tRNA-intron endonuclease catalytic domain-like 3.31e-31
Family tRNA-intron endonuclease catalytic domain-like 0.0000653
Further Details:      
 
Domain Number 2 Region: 3-73
Classification Level Classification E-value
Superfamily tRNA-intron endonuclease N-terminal domain-like 2.94e-17
Family tRNA-intron endonuclease N-terminal domain-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 187420.MTH250
Sequence length 170
Comment (Methanobacterium thermoautotrophicum)
Sequence
MRVEGQLGDEVVTIKATSIARRLHGKSHYGKMYEDRLQLSLIEAAYLMERGKLKLMKDDD
EVSPEEFISLLGERGLYSKYLVYRDLRNRGYIVKTGFKYGAEFRLYERGGAPGRTHSAYL
VRVISENDTIHALDFSSYVRVAHGVNKKLLMAFLDDEEDITYYLVDWIRP
Download sequence
Identical sequences O07165
gi|15678278|ref|NP_275393.1| 187420.MTH250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]