SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 187420.MTH34 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  187420.MTH34
Domain Number 1 Region: 9-148
Classification Level Classification E-value
Superfamily S13-like H2TH domain 4.71e-35
Family Ribosomal protein S13 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 187420.MTH34
Sequence length 149
Comment (Methanobacterium thermoautotrophicum)
Sequence
MEEEFKHMVRIARKDIDGNKTMENALTSIKGVGKALSRAIIMSAGYDLNQRIGYLSDEEI
ERLEEAIKNPAKYNIPSWMINRRNDYETGEDKHLIESDLEMCLREDLNRMRKTRSYKGRR
HELGLPVRGQRTKSTFRKGSSVGVRRKKR
Download sequence
Identical sequences A0A223ZDA5 O26141
187420.MTH34 WP_010875675.1.22989 gi|15678064|ref|NP_275178.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]