SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 188937.MA0028 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  188937.MA0028
Domain Number - Region: 46-102
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.00392
Family Pentapeptide repeats 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 188937.MA0028
Sequence length 144
Comment (Methanosarcina acetivorans)
Sequence
MNEQNLKNLLIELMVGICFIMPFLGNIVFQPIVFREFRFLGYRFLIYRFLIYRFSRIPFF
RLPFFNISFFNISFFEYCFSAYRFSRIPFFRLPFFNISFFRLPFFKTPFFIFRFFHRCLE
RQISFPKYKTTDVLKIEYNYPEVL
Download sequence
Identical sequences Q8TUN8
WP_011020087.1.98848 gi|20088927|ref|NP_615002.1| 188937.MA0028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]