SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 188937.MA0158 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  188937.MA0158
Domain Number - Region: 96-129
Classification Level Classification E-value
Superfamily Prefoldin 0.00497
Family Prefoldin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 188937.MA0158
Sequence length 132
Comment (Methanosarcina acetivorans)
Sequence
METMPHGDRTGPMGQGPKTGRAMGYCSGSDEPGYKTVTPVGAGRRAGRGMNRKAGCGAGR
GLGHRRTPGSGKGGQFASRGEYSGYYYPAPSQTGAESDIDFLEGRIKALKQELDKLTENL
KNFQSQENDKKE
Download sequence
Identical sequences Q8TUB5
gi|20089056|ref|NP_615131.1| 188937.MA0158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]