SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 188937.MA0893 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  188937.MA0893
Domain Number 1 Region: 84-174
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000174
Family Eukaryotic type KH-domain (KH-domain type I) 0.00062
Further Details:      
 
Domain Number 2 Region: 2-74
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000179
Family Eukaryotic type KH-domain (KH-domain type I) 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 188937.MA0893
Sequence length 182
Comment (Methanosarcina acetivorans)
Sequence
MTQYVKIPKERIGVIIGPKGETKKFIEEKTTCQLEIESDSGKIDVTCEDDPLKEFRILET
LKAIGRGFSPEKALQILDDDMLMLEVIDLSDIASTPKELQRIKGRIIGRNGRTRELAESL
INVKISVYGKTVSILGYPEQNTIIRTAVKMLLDGATHGAVYKFLEKKHQELLHSQLDSID
FY
Download sequence
Identical sequences Q8TSA5
188937.MA0893 gi|20089777|ref|NP_615852.1| WP_011020937.1.98848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]