SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 188937.MA0919 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  188937.MA0919
Domain Number 1 Region: 71-199
Classification Level Classification E-value
Superfamily PRTase-like 4.06e-29
Family Phosphoribosyltransferases (PRTases) 0.037
Further Details:      
 
Weak hits

Sequence:  188937.MA0919
Domain Number - Region: 8-43
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00896
Family Tetracyclin repressor-like, N-terminal domain 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 188937.MA0919
Sequence length 204
Comment (Methanosarcina acetivorans)
Sequence
MKNIEDLIQKAVELQNNGLVTGQIADELNVSRETVTWLLTRSKKEVAVPAPKDISVNWSS
IGKSATRLHYISLALCDMVLETLEKTNAEVDVVVGVAASGIPLASMMANELGADFALYHS
RKGQDVVQPGQKGTISRNFGSVVGKNCVIVDDVITTGSTTMEVIEQLREMGAKPRVVAVL
VDKKGADTIANVPIQSLVRIVRVD
Download sequence
Identical sequences P58862
188937.MA0919 gi|20089797|ref|NP_615872.1| WP_011020957.1.98848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]