SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 188937.MA1763 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  188937.MA1763
Domain Number 1 Region: 61-141
Classification Level Classification E-value
Superfamily ACT-like 8.55e-24
Family Nickel responsive regulator NikR, C-terminal domain 0.0016
Further Details:      
 
Domain Number 2 Region: 10-56
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.000000000119
Family CopG-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 188937.MA1763
Sequence length 145
Comment (Methanosarcina acetivorans)
Sequence
MSGDTMEAGLMRIGVSIPDALLTQFDEIIKKRDSPSRSEAIRDALISYITYYEWMEDIKG
RRVGTIAVIYDHKKSGLSNSIINVQHHYSHLIKYSVHMYLDTDDCFELIVLDGNGQEITE
LAGSIIALKGVKFSKLTTVDPNKKI
Download sequence
Identical sequences Q8TPZ0
gi|20090614|ref|NP_616689.1| 188937.MA1763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]