SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 188937.MA1828 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  188937.MA1828
Domain Number 1 Region: 128-308
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 8.54e-37
Family Lambda integrase-like, catalytic core 0.001
Further Details:      
 
Weak hits

Sequence:  188937.MA1828
Domain Number - Region: 324-343
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0216
Family Ran binding protein zinc finger-like 0.0043
Further Details:      
 
Domain Number - Region: 34-104
Classification Level Classification E-value
Superfamily lambda integrase-like, N-terminal domain 0.0286
Family lambda integrase-like, N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 188937.MA1828
Sequence length 388
Comment (Methanosarcina acetivorans)
Sequence
MTENIPWLDKISIDKDESMENYVSIKRYLRKIKNETTSEATLRNQCVALNIFAKWCDKDF
SELDEDDIYDYFDYLESYTYERNGKIKHYSETSIYLYKMALKKFLRIIEKEGLSKLIKCK
NPATKKLPEDILSKEDIEKLLSAARNPRDKALIATLYESGARKGELFSVRLKHIVFDENG
CIVTLPEGKTGARRVRLVFAASYLRQWIECHPTKDNRDSYLFVSSRDDHPLISTTALKEG
LDRISKRAGVKKRVNPHAFRHARATHLAGHLTEQQMKIYLGWTENSSMASVYVHLSGKDI
DDAILKMNGIIMDETHADGLRVGRCSRCKELNSESAMYCWKCGQPLREGAEKSVTTVNKE
MEDMLLKVLTENSALKEELMREFTKLKG
Download sequence
Identical sequences Q8TPS7
WP_011021830.1.98848 188937.MA1828 gi|20090679|ref|NP_616754.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]