SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 188937.MA2645 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  188937.MA2645
Domain Number 1 Region: 38-573
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 3.2e-141
Family Arylsulfatase 0.00000071
Further Details:      
 
Weak hits

Sequence:  188937.MA2645
Domain Number - Region: 624-763
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00475
Family Clostridium neurotoxins, the second last domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 188937.MA2645
Sequence length 784
Comment (Methanosarcina acetivorans)
Sequence
MPLKEYKPGTAFPGVIGRTADQSESAWPEPRRAKEGAPNVLFIVLDDTGFGQLGCYGSPI
NTPNLDSLAEGGLVYNNMHTTALCSPTRTCILTGRNHHSNNMACITEGSTGYPGYNGYIP
FENGFLAEMLLEHGYNTYAVGKWHLTPADQISSAGPYDRWPLGRGFERYYGFLGGETHQY
YPELVYDNHPVSPPKTPEEGYTLNEDLADRAIQFIADAKQVAPNKPFFMYFCPGAMHAPH
HVPKEWADKYKGKFDEGWEAYQEKTFARQKELGIVPKDAKISRHDPDVKPWGECLPEEQK
LYARMMEVFAGFLEHTDYHIGRLLQFLKDMGEFENTLIMVISDNGASSEGGPTGSVNENL
FFNNVPESLEENLPLLDKLGGPETFNHYAWGWTWAGDTPFRRWKRETYRGGVSDPFIVQW
PGGIRARGEVRTQYAHAIDMVPTVLECLGIEPPTVIKGVTQSPIEGVSFAHTLGNANAPS
RHHTQYFEMMGHRSLYHDGWRAVCPWPGPSFAEAGKPFGEPISAEKLTELDATGWELYNV
QKDWTENENVAAENRPKLIEMIATWYAEAGKYNVLPIDARGVLRLADERPQIAVDRTRYT
YYPGTQAIPANAAVNVLNRPHSITADVEIPAGGVEGVLLAHGGIDAGYSFYMKGGKLHWV
HNYVARALYHVESGEKVPEGRHQLRFEFEVTGEPDVASGKGAPGRAQLYIDGNLVGQAEV
PVTTPLMLGLTSGVTCGSAPGAPVTPDYRPPFEFTGKIYSVTVDVSGKLIEDKEVGMRMV
MARQ
Download sequence
Identical sequences Q8TML2
WP_011022605.1.98848 gi|20091468|ref|NP_617543.1| 188937.MA2645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]