SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 188937.MA4225 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  188937.MA4225
Domain Number 1 Region: 42-99
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000645
Family Cgl2762-like 0.019
Further Details:      
 
Weak hits

Sequence:  188937.MA4225
Domain Number - Region: 2-37
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 0.0497
Family Zn-finger domain of Sec23/24 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 188937.MA4225
Sequence length 144
Comment (Methanosarcina acetivorans)
Sequence
MNCPRCKSSNHTKNGIVCGRQRYKCHDCGYNYSVELKSTASSPLVKRQALQLYLEGLGFR
SIGRFLGVSHVSVQKWIKKFGQEIEELKSENEISIVELDEMHTYIGNKKNIAGSGLLLIE
LGKNSSTALLVAEERKLDNYSGKN
Download sequence
Identical sequences Q8TH58
gi|20091608|ref|NP_617683.1| gi|20092189|ref|NP_618264.1| gi|20092319|ref|NP_618394.1| gi|20093015|ref|NP_619090.1| 188937.MA2785 188937.MA3375 188937.MA3511 188937.MA4225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]