SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 189918.Mkms_3135 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  189918.Mkms_3135
Domain Number 1 Region: 1-141
Classification Level Classification E-value
Superfamily LigT-like 0.0000000000785
Family tRNA splicing product Appr>p cyclic nucleotide phosphodiesterase 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 189918.Mkms_3135
Sequence length 173
Comment (Mycobacterium KMS)
Sequence
MVHSVELLFDPDTDAAVRRIWDDLSAAGVRSQAANRSPSNRPHVTLTVAEDMADGVDEAL
RPLLGMLPFDGLIGAPMLFGTRALVLVRLLVPSAHLLDLHREVDRVCRPFVDGAPLPHTA
AGQWTPHVTLARRVPPEQLPAAVAVPGLGRDLRCRIVGLRHWDGNNRVEYPIT
Download sequence
Identical sequences A1UHM1
WP_011560468.1.20321 WP_011560468.1.47369 gi|119869167|ref|YP_939119.1| 164756.Mmcs_3075 189918.Mkms_3135 gi|108800041|ref|YP_640238.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]