SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 189918.Mkms_4038 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  189918.Mkms_4038
Domain Number 1 Region: 57-582
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 1.08e-121
Family Arylsulfatase 0.00000129
Further Details:      
 
Weak hits

Sequence:  189918.Mkms_4038
Domain Number - Region: 631-770
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000633
Family Vibrio cholerae sialidase, N-terminal and insertion domains 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 189918.Mkms_4038
Sequence length 793
Comment (Mycobacterium KMS)
Sequence
MSDSSPQNTGQQAAAAVRRDVLPIPDPRHVGLTTYDAKDPNTTYPPITRLRPPDGAPNVL
IVLIDDVGFGASSAFGGPCRTPVAERLAANGVKLNRFHTTALCSPTRQALLTGRNHHSVG
MGGVTEIATSAPGYSSIRPKDKAPISETLRLNGYSTSQFGKCHEVPVWEVSPVGPFDQWP
TGSGFEHFYGFVGGEANQYYPGLYEGTTPVEPAKTPEQGYTLTEDLADRAITWVRQQQAL
TPDKPFFMYFAPGATHAPHHVPREWSDRYRGEFDAGWDVLREQIFARQKELGVIPQDAEL
TRRHDEIPGWDDMPDRLKPVLARQMEIYAGFMEQTDHEVGRLIDAVDGLGALDNTLIYYI
IGDNGASAEGTPNGCFNEMCTLNGLAGIETEDFLLSKIDDFGTPDAYNHYAVGWAHALCA
PYQWTKQVASHWGGTRNGTIVHWPAGIDAVGQTRDQFHHVIDVVPTILEAADIPAPLMVN
GIAQAPIEGFSMMSTLRAADAAETHRVQYFEMFGNRGIYHDGWTAVTKHRTPWLSDQPAL
EDDVWELYGPGDWTQAHDLAADDPAKLAELQRLWLIEAVKYDVLPIDDRSYERFNPDISG
RPVLITGSTQTIFPGMRLMESCVLNIKNKSHSVTAELSVPESGAQGVVVSQGGGVGGWCL
YAHEGRLKYCYNFLGIEYYYVTAEAPLSAGDHLLRMEFAYDGGGLGKGGTVTLFCDGEAV
GTGRVDQSEPMAFSADEMCDVGSDSGSPTSPDYGPHDNAFTGRIDWVKIDIGAADHDHLI
TAEDKLNIAMSRQ
Download sequence
Identical sequences A1UK72
gi|119870068|ref|YP_940020.1| 164756.Mmcs_3964 164757.Mjls_3978 189918.Mkms_4038 gi|108800928|ref|YP_641125.1| WP_011561343.1.20321 WP_011561343.1.44017 WP_011561343.1.47369 gi|126436553|ref|YP_001072244.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]