SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 189918.Mkms_4467 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  189918.Mkms_4467
Domain Number 1 Region: 5-133
Classification Level Classification E-value
Superfamily HSP20-like chaperones 1.33e-34
Family HSP20 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 189918.Mkms_4467
Sequence length 149
Comment (Mycobacterium KMS)
Sequence
MLRFDPFSDLDTWTRGLLSSQTGSDRTPRFMPMDLCKIDDHYVLTADLPGVDPGSVDVNV
DNGTLTISARRTARSEESAQWLANERFFGSYRRQLSLGEGVDSAAISATYENGVLTVTIP
MAERAKPRKIEVAHGGGQKSIQPTTVDAE
Download sequence
Identical sequences A0A1A0TFZ0 A0A1X0H2H7 A1ULF0
gi|108801343|ref|YP_641540.1| gi|119870496|ref|YP_940448.1| 164756.Mmcs_4380 164757.Mjls_4761 189918.Mkms_4467 WP_011561757.1.20321 WP_011561757.1.3374 WP_011561757.1.37251 WP_011561757.1.44017 WP_011561757.1.47369 WP_011561757.1.73225 gi|126437326|ref|YP_001073017.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]