SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 190192.MK1444 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  190192.MK1444
Domain Number 1 Region: 6-58
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.4e-17
Family Ribosomal protein L24e 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 190192.MK1444
Sequence length 68
Comment (Methanopyrus kandleri)
Sequence
MPDVRRCDFCGRIIEPGTGKMFVKNDGTILWFCSSKCERNMLKLGRDPKKVRWTEKHREF
MAEQRGEL
Download sequence
Identical sequences Q8TVE8
190192.MK1444 gi|20094880|ref|NP_614727.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]