SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 190485.XCC4064 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  190485.XCC4064
Domain Number 1 Region: 60-338
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 2.3e-70
Family alpha-L-arabinanase-like 0.0000275
Further Details:      
 
Domain Number 2 Region: 359-541
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.61e-21
Family Beta-D-xylosidase C-terminal domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 190485.XCC4064
Sequence length 544
Comment (Xanthomonas campestris ATCC 33913)
Sequence
MPTPTRRDVFKLLAASAGAAVAPAALGATAAPPAAACGQLLQWGRGVEGQRTADLGNGTY
RNPIVAGDRPDPTILKDGDDYSMTFSSFFSYPGIVLWHSTDLVNWTPIGPALRQQLGTIW
ALDLCKHDGRYFIYIPANPDDRGWSIFVIWADDIRGPWSAPIDLKIAGCIDPGHVVGEDS
ARYLFVNGIRKIRLRADGLATDGPLEPAYAPWRYPDDWVVENFAPEGPKLNWHNGWLYLV
TAVGGTAGPVTGHMVIAARSRSVHGPWEHCPHNPLVRTQSPQEPWWSRGHATLVEGPRGD
WWMVYHGYENGFRTLGRQTLLEPIEWTADGWFRATGGDLSRPLRTPARTATGSANMATGF
ALSDDFSTDKLGTQWSLHAPKPGEQARIQRGDRVLTLACTGTSPADSAPLTCGVPDRAYA
AEVTLELVGNAEGGILLFYNHKAFVGIGFTADTMKTYEYSEELVWARAPNTQRHIRLRLT
NDQQVVTYHYSFDEGRNWLRHPTRMEVSGMHHNVFGGFLSLQLGIYAAQEGSVVLRDFRY
RALG
Download sequence
Identical sequences A0A0H2XCJ9 Q8P3K7
gi|21233486|ref|NP_639403.1| NP_639403.1.47755 WP_011039133.1.12496 WP_011039133.1.16446 WP_011039133.1.1732 WP_011039133.1.27778 WP_011039133.1.40219 WP_011039133.1.475 WP_011039133.1.56666 190485.XCC4064 314565.XC_4154 gi|66770451|ref|YP_245213.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]