SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 190486.XAC2153 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  190486.XAC2153
Domain Number 1 Region: 11-184
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.98e-27
Family Beta-D-xylosidase C-terminal domain-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 190486.XAC2153
Sequence length 196
Comment (Xanthomonas citri)
Sequence
MAQDSSWHAGTWLNRPKTLAINGDTLDVVTDQATDFWRKTHYGFTRDSGHFLGIRAGAGF
TAQLRARAQYEALYDQAGIMVRVDEQHWVKAGIELSDGRAMLSSVLTNPVSDWATGPYEA
DPKDFWIRATVADGVLRLQVSADGRRWPLVRLCPFPPASVYLVGPMCCTPERAGLKVRFS
DWALSAPLAKDLHDLS
Download sequence
Identical sequences Q8PKL8
190486.XAC2153 XaR30 gi|21242888|ref|NP_642470.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]