SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 190486.XAC2753 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  190486.XAC2753
Domain Number 1 Region: 85-216
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.26e-39
Family NlpC/P60 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 190486.XAC2753
Sequence length 217
Comment (Xanthomonas citri)
Sequence
MPGSEWAARWQTVEDGLSAAGCAAIMATFRTAHYPGSMHITPVFAASARRAAASLLLGLL
LLGGCSSHAPVRRPAAPPPAARVWPQVPPADPAAANNILMRALGLVGTPYRFGGNTPQTG
FDCSGLVTYVYQDVLALALPRTSRELAAIQGPRIPPERLATGDLVFFGAGGNVTHVGIYV
GEGRFVHAPTTGGTVRLDFLDGAYWRDHYSGSKRVLH
Download sequence
Identical sequences Q8PIZ1
gi|21243481|ref|NP_643063.1| 190486.XAC2753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]