SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 190650.CC_0380 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  190650.CC_0380
Domain Number 1 Region: 20-299
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-78
Family Glycosyl hydrolases family 16 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 190650.CC_0380
Sequence length 301
Comment (Caulobacter crescentus)
Sequence
MSRPLAVLAVCSALLAAGPVHARDDWKLVWSDEFNGTALDETKWTPAIDCGGGGNDERQC
YADSPETLSVQDGALRLTAIKRKTWGVVNPWAGPTGPLKAGDYASGKIVTQGKFSWRYGR
VEARARVPGGQGAWPAIWMMPELSTYGGWPRSGEIDILETVNLGAPCPPVGEACADGREN
RVFGTIHFAGDATGAHKQVSASTPLPASPDGFHVYAVEWSPEAIVWFLDGREYARAKPQD
WKRDDQPASAAPFDQPFHLIINLAFGGRWPESVNAKGIDEAALPATMEVDWVRVSQLASQ
D
Download sequence
Identical sequences A0A0H3C3G8 Q9AB54
NP_419199.1.61804 YP_002515759.1.80956 190650.CC_0380 565050.CCNA_00384 gi|221233323|ref|YP_002515759.1| gi|16124635|ref|NP_419199.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]