SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 190650.CC_0989 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  190650.CC_0989
Domain Number 1 Region: 6-315
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 2.28e-96
Family alpha-L-arabinanase-like 0.00000000305
Further Details:      
 
Domain Number 2 Region: 329-537
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.38e-67
Family Beta-D-xylosidase C-terminal domain-like 0.0000162
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 190650.CC_0989
Sequence length 546
Comment (Caulobacter crescentus)
Sequence
MSKDLIRNPVLRGFNPDPSIVRVGEDYYIATSTFEWFPGVQIHHSRDLRNWRLIGRPLRR
PSQLNMMGDPDGCGVWAPCLTHADGRFWLIFTDVKRYGRTTVGGASGASLRDFHNYLVTC
ETIDGDWSDPIHLNSSGFDPSLFHDDDGRKWLVNQLWDHRPGRNRFAGIVLQAFSVAEQR
LVGERKVIFEGTAIGLTEAPHLYKRDGWYYLLTAEGGTGWGHAATLARSRAIDGPYELHP
DTYLLTARDRPHAPLQRAGHGDLFETADGETYIAYLCGRPLPGRGRCVLGRETAIQKLTW
GADGWPRTLDGSGDPTLETPGAGLVDQPWPTTPVREDFDGTTLPIDFQWLRTPYPETIFS
LTARPGFLRLYGRESLGSVFTQALVARRQQAHCYSAATRLDFEPAHFQQAAGLVCYYNGS
KLHYLHVTHDDEAGKHLRVMTCTPDSPQADSFTAPIPLGAGPVDLRVEVDFERLRFGFRQ
AGGDWRWLPEVFDASILSDEATAPGAPNFTGAFVGMACQDMSGMATAADFDWFDYQERDY
VAQWPA
Download sequence
Identical sequences A0A0H3C5C2 Q9A9J1
190650.CC_0989 565050.CCNA_01040 gi|221233977|ref|YP_002516413.1| NYSGXRC-6303c NP_419805.1.61804 YP_002516413.1.80956 gi|16125241|ref|NP_419805.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]