SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 190650.CC_1387 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  190650.CC_1387
Domain Number 1 Region: 2-59
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000000407
Family Cold shock DNA-binding domain-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 190650.CC_1387
Sequence length 64
Comment (Caulobacter crescentus)
Sequence
MKWFNRTKGYGFVIRDAEPGDIFVHIETLRRGGLEDLQPGDDVLVRFARGPKGLVVAEIS
AGDA
Download sequence
Identical sequences Q9A8G7
190650.CC_1387 NP_420200.1.61804 gi|16125636|ref|NP_420200.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]