SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 194439.CT0168 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  194439.CT0168
Domain Number 1 Region: 9-83
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.000000000000155
Family Ferredoxin domains from multidomain proteins 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 194439.CT0168
Sequence length 95
Comment (Chlorobium tepidum TLS)
Sequence
MRKRLLAPREEIAWYPAIDADICNGCEACAEFCRPGVFAPGAPEPDAAVVKRPKMQVAHP
MNCLVLCTRCVPVCPSGAITLPDPLDFERFVEYIE
Download sequence
Identical sequences Q8KG02
gi|21673009|ref|NP_661074.1| 194439.CT0168 NP_661074.1.51846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]