SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 194439.CT1649 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  194439.CT1649
Domain Number 1 Region: 308-505
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.25e-49
Family Ribonuclease PH domain 1-like 0.000012
Further Details:      
 
Domain Number 2 Region: 11-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.06e-44
Family Ribonuclease PH domain 1-like 0.0000439
Further Details:      
 
Domain Number 3 Region: 468-564
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 7.2e-27
Family Ribonuclease PH domain 2-like 0.0000756
Further Details:      
 
Domain Number 4 Region: 145-236
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 9.03e-27
Family Ribonuclease PH domain 2-like 0.002
Further Details:      
 
Domain Number 5 Region: 572-657
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.14e-21
Family Eukaryotic type KH-domain (KH-domain type I) 0.0018
Further Details:      
 
Domain Number 6 Region: 637-718
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000000109
Family Cold shock DNA-binding domain-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 194439.CT1649
Sequence length 733
Comment (Chlorobium tepidum TLS)
Sequence
MFIKKKIDLGHGKVITIETGKMAKQADGSAVVTMNDTMVLATVVSSKTPPSPNQDFFPLQ
VEYREKYSAAGKFPGGFFKREGRPSEKEILSARLIDRALRPLFPDGYYQETQIIISVISS
DTINDADVLGGIAASAAIMVSDIPFANPMSEVRVGRINGLFIVNPDINELAQSDMDICIG
GTEDTICMLEGEMKEISEAEMLDAIKFGHDAIKKICALQRELAAEVAKPKRPFSPTVAPD
ELVNFVEEHCSAELKALAYTPLAKEERAEKTKAIYTQTIRKTLTHFTDRVGPDQIEADPT
SAFCLNEHMIEECIHAVEKKVMRHMILDDGKRLDGRTLEQVRPISIELGLIPRAHGSALF
TRGETQALVTLTLGTKKDAQSVDTLTDDKDKRFMLHYNFPPFSVGEIGRVGGAGRREIGH
GNLAERAIKMVMPSEQEFPYTVRLVSDILESNGSSSMASVCGGTLAAMDGGIPLKKPVSG
IAMGLIKEGDRYAVLSDILGNEDHLGDMDFKVAGTRDGITACQMDIKIDGLDYHILETAL
EQARKGRLHILDVMAEAIPESRADIGKYAPRLTTIQIPVDAIGMVIGKGGETIRSITEET
GAEINIDDDGTVTIACSSPEATKAAVETIKTLVSKPEVGTIYMGKVRDIRDELGAFVEFL
PKTDGLVHISEIARERIAKVSDVLKVGDRIKVKLIDVRKDPRTGKTKFALSIKALLDTDQ
QAETNGEAKPARD
Download sequence
Identical sequences Q8KBY3
194439.CT1649 gi|21674467|ref|NP_662532.1| NP_662532.1.51846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]