SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 194439.CT1936 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  194439.CT1936
Domain Number 1 Region: 124-297
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 1.26e-55
Family NadC C-terminal domain-like 0.0000164
Further Details:      
 
Domain Number 2 Region: 13-123
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 7.77e-30
Family NadC N-terminal domain-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 194439.CT1936
Sequence length 300
Comment (Chlorobium tepidum TLS)
Sequence
MAVMAEKRTNHAFREFFETCRLKAMQLALEEDRFQGDITTEATVDQNQLGLGYIEVKSEG
IIAGVEVARQVFQSLDAALEFTAYVKDGKRVYPGERVLEVKGRIASILIGERTALNFMQR
MSGIATRTNMYVERVSHTNASILDTRKTAPALRYYDKEAVRIGGGTNHRFGLFDMILIKD
NHIDAAGSVEEAIRRAKAYCQEQGVSAKIETEVRSISELVRACASRPDMILLDNFMVDDL
AEAVRWIKANGFGNILLEASGNIGLHNVSEVAMTGVDFISIGELTHSVKALDMSMKIERA
Download sequence
Identical sequences Q8KB55
NP_662813.1.51846 194439.CT1936 gi|21674748|ref|NP_662813.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]