SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 195099.CJE1390 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  195099.CJE1390
Domain Number 1 Region: 313-508
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.11e-45
Family Ribonuclease PH domain 1-like 0.0000465
Further Details:      
 
Domain Number 2 Region: 3-139
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.42e-40
Family Ribonuclease PH domain 1-like 0.00011
Further Details:      
 
Domain Number 3 Region: 471-565
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.44e-26
Family Ribonuclease PH domain 2-like 0.00011
Further Details:      
 
Domain Number 4 Region: 141-251
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.25e-21
Family Ribonuclease PH domain 2-like 0.0038
Further Details:      
 
Domain Number 5 Region: 576-676
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000672
Family Eukaryotic type KH-domain (KH-domain type I) 0.0036
Further Details:      
 
Domain Number 6 Region: 649-715
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000899
Family Cold shock DNA-binding domain-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 195099.CJE1390
Sequence length 719
Comment (Campylobacter jejuni RM1221)
Sequence
MQYSIEINKNTEIFNIDKVAKQAAGAVLMRQGKSVVLATVAREEKQVEEDFLPLTVQYIE
KAYAAGKIPGGYVKRETKPSDAETLTARIIDRSLRPLFPKGYAYPTQIVVMVLSADPKVD
LQVMSLNAASVALYLSDIPMKAPVCGVRIGKIDGNFILNPNNEELQNSTLDLYVAGVKDE
LLMIEMRALPDQKENEIFIEAPYADVLTQTTSQNMNELSEDEILEALNLAQKAILNGSNA
YEEAFSKHKKNSQIELKNEIEYPEILAFIENNFQKQIKEAINQMAKSERASELNKIAKEI
SNLEIAKEWSEESVLNTLAKVKRKLIRGQILNEGKRADGRSLNEVRPISIETNILPNAHG
SCLFTRGQTQALVVATLGGENDAQMIDLLTEKNPISERFMVNYNFPGFSVGEASPIKAPG
RRELGHGNLAKRALYPSVDENYPYVIRLVSEILESNGSSSMATVCGGSLALKAAGVPSLK
LVAGVAMGLIFEDNKYAVLTDIMGLEDHDGDMDFKVAGSKDGVTALQMDIKLGGIDQETL
KQALYQAKEGRIHILNIMEEAAKEIIVNEEVLPKLELFSVDPSKIVDIIGQAGKTIKEIV
EKFGVSIDLDREKGEVKIAGSQNEQIKAAKDYIINITSSQKGTKKGSKDKDISGFELGQE
FQGIVKKIAPFGAFVELKNGVDGLLHSSKSKHLNLSENQSLKVKISEIKNGKISVDLCE
Download sequence
Identical sequences A0A291TVD5 Q5HTK8
gi|384443600|ref|YP_005659852.1| WP_002908583.1.14405 WP_002908583.1.26081 WP_002908583.1.26811 WP_002908583.1.41676 WP_002908583.1.5263 WP_002908583.1.57275 WP_002908583.1.73810 WP_002908583.1.77662 WP_002908583.1.79874 gi|57238127|ref|YP_179377.1| 195099.CJE1390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]