SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 195102.CPE0010 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  195102.CPE0010
Domain Number 1 Region: 6-14,44-96
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.000000136
Family MioX-like 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 195102.CPE0010
Sequence length 97
Comment (Clostridium perfringens)
Sequence
MFSKLGLLHDIGKLYYPLNIITKSFLVLGKKISKNRISKFQNIKPIYIYYNHGDKAFDYL
REDDYDKEFVEAIRGHHSIKSSENILLCILKEADDMN
Download sequence
Identical sequences Q8XPF3
gi|18308992|ref|NP_560926.1| 195102.CPE0010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]