SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 195102.CPE2018 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  195102.CPE2018
Domain Number 1 Region: 2-166
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 9.03e-43
Family Predicted metal-dependent hydrolase 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 195102.CPE2018
Sequence length 168
Comment (Clostridium perfringens)
Sequence
MIFIDNRQNKFDVTEELTTKLEEVISFVLKEEKVKEDCEVSLVFVDNEEIRGINNETRGI
DKATDVLSFPMIDYPEDKVYKDVYLEHEFDKCYFDGDELILGDIVLSLERTKEQSIEFNH
SFEREACYLVTHSVLHLLGYDHMEEEEKARMRGREEELLGKLNITRES
Download sequence
Identical sequences Q8XIU5
WP_011010728.1.32463 195102.CPE2018 gi|18311000|ref|NP_562934.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]