SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 196162.Noca_1235 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  196162.Noca_1235
Domain Number 1 Region: 4-190
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 3.36e-37
Family ATP-dependent DNA ligase catalytic domain 0.003
Further Details:      
 
Domain Number 2 Region: 199-309
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000000126
Family DNA ligase/mRNA capping enzyme postcatalytic domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 196162.Noca_1235
Sequence length 311
Comment (Nocardioides JS614)
Sequence
MESMRPMLATHGRQVPTGEAWAHEVKWDGVRALTEVRDGALRMTSRNENAITIAWPELAT
SPLGDRDLLVDGEIIALNERGLPDFRTLQDRMHVRKAATAARLSREVPATYMVFDVLRID
GRDLTGEPLDVRRELLAGLGLDGTWQVPGSYDDGPMLFEATLQQGFEGIVSKRRSSRYAF
GERSPHWLKFAHRHRVSYVVGGWRPQEGTADRLASLLVGEPTADGLLYRGRVGSGIGPKQ
GRALAELVARLGRPASPFADEVPRADAQGTRWLEPVLVVDIDTHGRGYQRLRQPSFQGVR
SDLTPEDLCST
Download sequence
Identical sequences A1SG14
WP_011754697.1.100580 WP_011754697.1.96005 196162.Noca_1235 gi|119715471|ref|YP_922436.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]