SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 196162.Noca_4546 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  196162.Noca_4546
Domain Number 1 Region: 324-499
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000684
Family Glycosyl hydrolases family 16 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 196162.Noca_4546
Sequence length 538
Comment (Nocardioides JS614)
Sequence
MLSFSRGRSGEPAQRRALVALTSLFLLVASLALVTLPSGQPAYGASASLAVSPATYVGGQ
RLTWTGNVGAPGVRSLALQFHMGRPGDTWTTVAGFGAKTRADGSFSFAYPAPGMFNIRYR
VKAGSHVSPSKLFLAKTQDLTLRVTGQRENNSGTPALVPADEPFGITVDTTPDNIFRSPS
SQGLPVFPGRTLTLQRRIDGDTWRAVATTKVGDDGLGRFTGLTRPSGVSVFRVREEDYRQ
DGNEIGWTQSFPLFVYVGTDAWAQYDRQQLAARATPSLPPGDSASFGSGAPTPTASERYG
WYPLYWDFAWEHGQSLTGGPARGTRPRGHWVDYVDGAGRVSKQNGQLALDSKRFYGAGPG
DFGSTRATLTGNAVAQGRWEARMRIRGAYETGGRAYGVRAELVPEQTSGRACNSRTIEIA
SISPFSRKVRFGARSAKYRWSGAATASATPLHSAYAVAVEVAKGHITWFLDGKPVGSVTD
RAAFPGVPMTLRLTLTGQGREEMNQVSLVSDWQRGFPLASGRQTISRDKLKRQPANGC
Download sequence
Identical sequences A1SQF8
WP_011757971.1.100580 WP_011757971.1.96005 gi|119718765|ref|YP_925730.1| 196162.Noca_4546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]