SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 196162.Noca_4875 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  196162.Noca_4875
Domain Number 1 Region: 97-126
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000362
Family Prokaryotic DksA/TraR C4-type zinc finger 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 196162.Noca_4875
Sequence length 127
Comment (Nocardioides JS614)
Sequence
MPSHAPSSARASSSAPEGVAHPSTCQGPHMTTSDASSLNAFTNMHDYLATVEDARRRQLD
ALPTRTLDPVEAAHRAAVEQIVDEVVTARHRLTVGLYGVCTGCEEPIATERLEFRPWATT
CIKCSQR
Download sequence
Identical sequences A1SCC2
gi|119714178|ref|YP_919320.1| gi|119714178|ref|YP_919320.1|NC_008697 196162.Noca_4875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]