SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 196164.CE1868 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  196164.CE1868
Domain Number 1 Region: 37-177
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.77e-45
Family Ribonuclease PH domain 1-like 0.000000802
Further Details:      
 
Domain Number 2 Region: 366-537
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.62e-43
Family Ribonuclease PH domain 1-like 0.000000711
Further Details:      
 
Domain Number 3 Region: 519-618
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.51e-23
Family Ribonuclease PH domain 2-like 0.0000181
Further Details:      
 
Domain Number 4 Region: 289-395
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 1.57e-22
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.00076
Further Details:      
 
Domain Number 5 Region: 179-299
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.21e-21
Family Ribonuclease PH domain 2-like 0.0000224
Further Details:      
 
Domain Number 6 Region: 626-713
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.35e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0041
Further Details:      
 
Domain Number 7 Region: 694-762
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000000269
Family Cold shock DNA-binding domain-like 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 196164.CE1868
Sequence length 769
Comment (Corynebacterium efficiens YS-314)
Sequence
MAPMITERTKHEENNSHMSEVKYFEDTDYGVIEAIATIDNGDFGTRTIRFETGQLARQAD
GAVTTYLDDETMLLATTTASNQPREGLDFFPLTVDVEERMYAAGRIPGSFFRREGRPSTE
AILACRLIDRPLRPTFVKGLRNEVQVIITVMSVSPEDSYDVVAINGASAATRISGLPVSG
AVGGVRMALIADENHPEGQWVAFPTAEQQKASVFELVVAGRLVERKRGNKTFSDVAVMMV
EAGASENVVERIKEGAPAPTEKTVAEGLEAAKPFIDLLCRAQEGLAQRVAKETREFPLFP
AYSDEVYAAVEKQASKKLTQLMTIKGKNERENATNDFMVEVEEKLIGRFEDDLGAAVASK
EIRAAYNSLMKKIVRGKILSEGFRIDGRGVSDIRDLGVEVELIPRAHGSSLFERGETQIL
GVTTLDMLKMEQHIDSLAPVDTKRYMHHYNFPPYSTGETGRVGSPKRREIGHGALAERAV
LPVIPSREDFPYAIRQVSEALGSNGSTSMGSVCASTLSLYNAGVPLKAPVAGIAMGLVSD
EVDGKTEYVALTDILGAEDAFGDMDFKVAGTAEFITALQLDTKLDGIPSKVLADALEQAR
DARLAILETMAEVIDGPDEMSQFAPRITTIQIPVSKIGELIGPKGKNINALTEETGANIS
IEDDGTVFISAASGEAAEAAIEKINALANPQLPKVGERFLGTVVKATAFGAFVSLLPGRD
GLVHISKLGNGKRVEKVEDVVTVGEKLQVEIADIDNRGKISLVPVVEED
Download sequence
Identical sequences 196164.CE1868 gi|25028424|ref|NP_738478.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]