SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 196600.VV0892 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  196600.VV0892
Domain Number 1 Region: 1-239
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.69e-83
Family ABC transporter ATPase domain-like 0.0000000366
Further Details:      
 
Domain Number 2 Region: 248-343
Classification Level Classification E-value
Superfamily ACT-like 9.5e-27
Family NIL domain-like 0.00000552
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 196600.VV0892
Sequence length 344
Comment (Vibrio vulnificus YJ016)
Sequence
MIEINQVNKVFYQGSKEIHALKDINLHIAEGTIFGVIGSSGAGKSTLIRCVNMLEAPTSG
SIVVDGVDLTKLSKKQLSETRRNIGMIFQHFNLLSSRTVFDNVALPLELAGKDKEQIQSK
VTELLKLVGLADKHESYPANLSGGQKQRVAIARALASDPKVLLCDEATSALDPATTQSIL
ELLKEINRKLKITILLITHEMDVVKSICHEVAIIGGGELVEKGTVGEIFAHPKTELAHDF
IRSTLDLSIPEDYQARLQPTRVAGSYPLVRLEFTGATVDAPLVSQISRKYNIDISILSSD
LDYAGGVKFGMMVAELFGNEEDDNAAIEYLREHNVKVEVLGYVL
Download sequence
Identical sequences A0A1V8MZT3 Q7MN25
196600.VV0892 gi|37679076|ref|NP_933685.1| WP_011149699.1.34622 WP_011149699.1.39524 WP_011149699.1.82587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]