SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 196600.VV1498 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  196600.VV1498
Domain Number 1 Region: 4-89
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.21e-21
Family Glutathione S-transferase (GST), N-terminal domain 0.00035
Further Details:      
 
Domain Number 2 Region: 95-219
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 3.63e-20
Family Glutathione S-transferase (GST), C-terminal domain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 196600.VV1498
Sequence length 222
Comment (Vibrio vulnificus YJ016)
Sequence
METSLKLYGYWRSSAAYRVRICLNLKQLRYENYSIHLVKNGGEQHLAHYHALNPNELVPV
LVDGDLVLNQSLAIIQYLDDNYSSTQVIPSMGPLKYQALALAQDIAIDVHPLNNLRVLQY
LEGSLEVDEEQKRLWVHHWINTGFKAVEEKLMAHRKHYGECVFSVSSSPSIVDICLVPQV
YNALRFGVNMAPYPTINAVVAACNQLPAFDLAKPENQPDAQL
Download sequence
Identical sequences Q7MLC9
WP_011150133.1.34622 196600.VV1498 gi|37679682|ref|NP_934291.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]