SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 196600.VV1892 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  196600.VV1892
Domain Number - Region: 83-116
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.00085
Family DNA primase zinc finger 0.063
Further Details:      
 
Domain Number - Region: 27-72
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0396
Family SPRY domain 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 196600.VV1892
Sequence length 117
Comment (Vibrio vulnificus YJ016)
Sequence
MFTRWIVDMDEKVQVAFGVWAGVSLLGYVLFYANKNTQFKRKYYPAFSVVTGALFLFIVN
LMGFFKHQFWIVIVPIVALITFMNIRGAKFCDNCGKSNFTQSLQDRKIECQKCGHTI
Download sequence
Identical sequences Q7MKB3
196600.VV1892 gi|37680076|ref|NP_934685.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]